1. Notes: 8 / 3 weeks ago 
    Thinking this is the pic for the book jacket. What do you think?

    Thinking this is the pic for the book jacket. What do you think?

     
    2. Comments
  2. Notes: 4 / 3 weeks ago 
    The Apple Tablet has been seen in the wild!

    The Apple Tablet has been seen in the wild!

     
    3. Comments
  3. Notes: 13 / 3 weeks ago  from bt
    BT's new single "Suddenly" is now available on iTunes!

    (via bt)

    4. Comments
  4. Notes: 1 / 3 weeks ago 
    My thoughts exactly.

    My thoughts exactly.

     
    5. Comments
  5. Notes: 16 / 3 weeks ago 
    a new picture! what do you think?

    a new picture! what do you think?

     
    6. Comments
  6. Notes: 9 / 1 month ago  from icanmakewaffles
    icanmakewaffles: In the editor’s letter of the February issue of Lucky, Kim France mentions a few Valentine’s Day gift ideas, including something called a regard ring. Regard stands for ruby, emerald, garnet, amethyst, ruby, diamond, and France says that in Victorian times, rings with stones in that order were like friendship rings. I was really intrigued by this concept and tried to find out more about these rings.According to Wikipedia and a couple other not-so-reliable looking websites, it’s actually called a regards ring — apparently Lucky left off the sapphire at the end of the sequence — and they were Victorian engagement rings. It seems it was also common to spell out “dearest” (diamond, emerald, amethyst, ruby, emerald, sapphire, topaz), “love” (lapis lazuli, opal, vermarine, emerald), or the woman’s name, provided it wasn’t too long.This reminds me a little of the trend of wearing jewelry set with kids’ birthstones that cropped up a while ago among mothers, but I might like the regards ring better. It has such a cool, though not very well-documented, history, and I think a thin ring with teeny tiny stones would make a really special, delicate wedding or engagement ring. (Flickr, Wikipedia, Chest of Books, Engagement Rings)

    icanmakewaffles:

    In the editor’s letter of the February issue of Lucky, Kim France mentions a few Valentine’s Day gift ideas, including something called a regard ring. Regard stands for ruby, emerald, garnet, amethyst, ruby, diamond, and France says that in Victorian times, rings with stones in that order were like friendship rings. I was really intrigued by this concept and tried to find out more about these rings.

    According to Wikipedia and a couple other not-so-reliable looking websites, it’s actually called a regards ring — apparently Lucky left off the sapphire at the end of the sequence — and they were Victorian engagement rings. It seems it was also common to spell out “dearest” (diamond, emerald, amethyst, ruby, emerald, sapphire, topaz), “love” (lapis lazuli, opal, vermarine, emerald), or the woman’s name, provided it wasn’t too long.

    This reminds me a little of the trend of wearing jewelry set with kids’ birthstones that cropped up a while ago among mothers, but I might like the regards ring better. It has such a cool, though not very well-documented, history, and I think a thin ring with teeny tiny stones would make a really special, delicate wedding or engagement ring. (Flickr, Wikipedia, Chest of Books, Engagement Rings)

     
    7. Comments
  7. Notes: 1 / 1 month ago 
    Want.

    Want.

     
    8. Comments
  8. Notes: 4 / 1 month ago 
    I’m trending on Twitter! (thanks for pointing it out, Naveen.)

    I’m trending on Twitter! (thanks for pointing it out, Naveen.)

     
    9. Comments
  9. Notes: 11 / 1 month ago  from kmaverick
    kmaverick: MIND. BLOWN.

    kmaverick:

    MIND. BLOWN.

     
    10. Comments
  10. Notes: 36 / 1 month ago  from soupsoup
    "As to methods there may be a million and then some, but principles are few. The man who grasps principles can successfully select his own methods. The man who tries methods, ignoring principles, is sure to have trouble."
    - Ralph Waldo Emerson (via soupsoup)
    11. Comments
avatar_128
 
 
donnie darko is my favorite movie and i wear heels every single day
 
 

Following

whatsthebeefvirginiaisforzombiesnickmcglynnmerlinchrispetesciadavidshetbagsarahcooleysoupsouptylerhwillisemeschartiergianniitumbledorethefrogmanriordanknitwitrnerdgasmslorenrochellegluttonyisablisspoobahbritjennydeluxeicanmakewafflesrypurtazizisboredsosexyoutofcontextrafermashablebriansolissahilmicahbaldwincaroalexblaggmknellboxofchocolatestopherchrisblakeleythatsaboldmovemdfsmashbananasmusicclubdpstylesappleartsgarfieldminusgarfieldalexismichellekmavericktwentysomethingtalesnoneckzachlinderashponderswesley83jonsteinbergwhitewhinelookatthisfuckinghipstershaneguiterzarzecksfred-wilsonalexandergordonhateitorloveitmagerleaguesnaveenadamisskarenhjordantumblesjohncarneypilescandalousmarcodevteammrgnpetswhowanttokillthemselvesstevepolandceonyccoskayrickyvthisiswhyyourefatmikehudackrmblrbrianxchendeermoosetypeonefuckyeahsharksscottnotdavemorinlollercoasterbtmarkpeterdavisinnonatessravpingridmichaelsonbytesfromrealityjacobmullinssamhuleattmbaratzquiknessskidderpop17mattbuchananrhapsodyartistlunchfoodtanelkevinrosecrispycrackaalaskamillerpaulruddsnarshadjasonoliverfromedomemvanhorndinosaursfuckingrobotsletthemeatmeatjosephweisenthalgettingoutoftheroomdavidohalloranchrishughesemilydeeadobegripesrandallbdatainsightsideaskhoffchrisabrahamronen-postsjonathanlarkindwfthnyousefiunofficialphotographerrainbowsarehotgruenjwilkerekaiscubadivergirlsstevebanfieldbrettfayzacandrewskanyegatebyetmanlucasjoshwhatwoulddondraperdofuckyeahannehathawaykatyperryblogcorndujouridanielhopefulspecklarissafairtrumcgowanjackiepetersbaugherdaveandmatthypokalemicalexknowsplaytoniqnickguidodentonfuckyeahgodgarybuseyfaketwitterstatusdeleonnnnnnmicahchiccabdriverstellmeimprettylockboxnyctalkhipstersareevilnimayousefiranajunetvimeldapracticalmanmhendricm16yipe
 

Tumblr